SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297526651|ref|YP_003668675.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297526651|ref|YP_003668675.1|
Domain Number 1 Region: 175-496
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.21e-113
Family Leucine aminopeptidase, C-terminal domain 0.000000179
Further Details:      
 
Domain Number 2 Region: 5-179
Classification Level Classification E-value
Superfamily Macro domain-like 1.12e-17
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297526651|ref|YP_003668675.1|
Sequence length 499
Comment Leucyl aminopeptidase [Staphylothermus hellenicus DSM 12710]
Sequence
MAKLKYILSDKSLDKIDVDTLIVPVISENNKPRIPEEIRDAYRELIDTIISSGDFKGEEK
EVIIGYSRNRIKRLVLAGLGKEPDHETFREAVASAINSIAEKQSVHAGLYLRDLKNIFEI
SDLIDNSVLTIEITLFDPGELFKTENKKLTLKEMVLIVDNISEDMENALKRSTIISDAVN
YARRIAETPSSTMNPARIEEEAKKLAEQYGLEIKVFQKEDLEKMGMNGILAVGSGGGIPP
RLIILEYRGRNSNEWDYAFVGKTVTFDAGGLNLKPTGYIDNMKYDKCGGAVVLGIMKAVA
ELKLPVNVVAALPAVENLPGPNAYKPRDVIKMYNGLTVEVGNTDAEGRLILADALSYIDK
NYTPKQIFDLATLTGAIVIALGNYAAGLFTENDEVAKKLYDIGWKIGERVWHMPLWKEYY
EQLKSNIADTNNIGGRPAGAITAAAFLSKFVSDKKRWIHLDIAGVSFVEKGYPKKAYYKP
AATGFGVRLLTYYLLKDLE
Download sequence
Identical sequences D7DC79
WP_013142974.1.49614 gi|297526651|ref|YP_003668675.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]