SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297526687|ref|YP_003668711.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297526687|ref|YP_003668711.1|
Domain Number 1 Region: 6-194
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 3.27e-21
Family Cation efflux protein transmembrane domain-like 0.005
Further Details:      
 
Weak hits

Sequence:  gi|297526687|ref|YP_003668711.1|
Domain Number - Region: 224-271
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00732
Family Bacterial exopeptidase dimerisation domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297526687|ref|YP_003668711.1|
Sequence length 281
Comment cation diffusion facilitator family transporter [Staphylothermus hellenicus DSM 12710]
Sequence
MKDKAAVNLVAIIILALIGGLVKIYGGIYYSSKSLFVDALTSFANIVALIFTVYFYKLSI
SPPDIDHPYGHHRLGIGGIIASIAAYSFVAGVSSIELIYSTKYTVQLQAVYYAIAGFIIY
SITILLAIRIGSIFRTYGAFTVSELIESIIVILASLGGALYYYLIDYVGAIILTLYIFYE
IMVSTREILSITSDKAPPYEILTSIRELFEKNQFTIQDMKIRTIHPGKYHGVFEVRSLDS
KNYEEIWKRIENIKRTLLEKYGVESVIEVIPNTNRNKFYKN
Download sequence
Identical sequences D7DCB5
gi|297526687|ref|YP_003668711.1| WP_013143010.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]