SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297526719|ref|YP_003668743.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297526719|ref|YP_003668743.1|
Domain Number 1 Region: 11-197
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.56e-24
Family Molybdenum cofactor biosynthesis protein MobA 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297526719|ref|YP_003668743.1|
Sequence length 223
Comment Molybdopterin-guanine dinucleotide biosynthesis protein A-like protein [Staphylothermus hellenicus DSM 12710]
Sequence
MAEAIDDMGKLKIAVLAGGLSTRFGSNKLFYTINGKPLILYVYERLISIFDEENIFFIAS
PHNAVLLRKIGLSNVLIDDILKGPISGIYIALKNLGDVFVFGGDMPCLNRELLIEMLNIW
IENKFLALVPGWRKGFLEPLHAIYSGELLSVFEKSISCGELSITRLINKLDNKKILYLDD
YPLEQKLSVYNVNTRDDIRCVEEGLIKKLPEPCLECLIYRERS
Download sequence
Identical sequences D7DCE7
gi|297526719|ref|YP_003668743.1| WP_013143042.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]