SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297526750|ref|YP_003668774.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297526750|ref|YP_003668774.1|
Domain Number 1 Region: 5-83,175-349
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.96e-69
Family Bacterial dinuclear zinc exopeptidases 0.00000367
Further Details:      
 
Domain Number 2 Region: 71-180
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.83e-31
Family Aminopeptidase/glucanase lid domain 0.0000912
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297526750|ref|YP_003668774.1|
Sequence length 364
Comment Cellulase [Staphylothermus hellenicus DSM 12710]
Sequence
MNKNELYETLEKLTSIVSPSGHEDEIRNTIIELLKPYADELWVDSLGNIIAVKKGSSEGR
LMIAAHMDEIGLMINHITKTGFLKFTPIGGWNSVILPGQRVLIKTKRGEYVRGVIGMKPP
HIMKPEEAKQAPQIGDLFIDIGASSREEVGKLGVTIGSVAVIERSIAKLSGDVVTGRAFD
DKVGVAVLIEAFKNLEKPKVDVYAVATVMEEVGLKGARVAAYSITPYVGLALDVTIAADV
PGVDESKQITKLGKGPAIKVMDGRSGSGLIAHPAIKNTLIQLAEQHNIPYQLEVLTGGTT
DATIIQLTKEGVPTGALSIPTRYIHSPVEVLNLEDALNTAKLTKLFAEHIDIEWINKYLK
RKIK
Download sequence
Identical sequences D7D7X9
WP_013143073.1.49614 gi|297526750|ref|YP_003668774.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]