SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297527028|ref|YP_003669052.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297527028|ref|YP_003669052.1|
Domain Number 1 Region: 62-111,245-365,412-483
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.72e-18
Family Bacterial dinuclear zinc exopeptidases 0.088
Further Details:      
 
Weak hits

Sequence:  gi|297527028|ref|YP_003669052.1|
Domain Number - Region: 106-192
Classification Level Classification E-value
Superfamily PA domain 0.0772
Family PA domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297527028|ref|YP_003669052.1|
Sequence length 1476
Comment hypothetical protein Shell_1049 [Staphylothermus hellenicus DSM 12710]
Sequence
MKKTIFIYLFFLIIVSLFASINYTGAYSVSSNNNFLNDPVFDVFNKNININLTATNTSAK
LNHYLNLFAGIHDRLTGHRGYFEATRILYNLIKNITVNVVLDNYTVVIPVDEGSYLKVDN
RTIKVYPIWPSGGVPVNAICKGKIIVADSINDLNGVDLHGSIVLISYSNDWRWLWLLDPH
LGVKAILFYEDNIVNSQNYDKYLDTPVDLPIGYISTRMLKEEYGLTLSDLNGKRGYLELR
SKWVEVNVSNIVAYVPGQNHDYRIVLGAHYDSWSPVVGFAPGATDALAPIYLLMYAEKLV
NKTPQYDTIIVWFSGYYEGLEGQRHFVDKYIFNKQKLSFGNISIVINPAKTLFIGLDLNY
RSKYIAPTSIGYFYTAQAVGITRGPINYYAGFISNVFDLNRLEQSVSNKLGKDLGSAIRQ
LFSYSRDPNTWWALFPGPYWLDTEPFWSSGLAAFTLKSAFAEKGAKGTPIDYFDKINSEN
IVLQYNLLDIILDQIYSKNPQQLRDAISAGFSPNAPTRISTSPRNEMFANLIGQVMVWNP
KLGQRVNLKKANLSRALVIISAGSRTQTSSPWNLRIVRFTDDEGYFTVEGLPTSRSTGLT
ITALVLSDNGNVVALNVMGTVSRGSSVSISQPVLGSKQAPWEVWIIKFKGNITVNMVVDP
LSYQIPIEGGSIGCRIVRTDTMAEPDYYYIGIDETGFLVAYLYKDLNYSLVFGPDPVFYV
IENVRIGHKYSLYDALSSTINIVDRRLEKLSSYKIRNPAAEEFVTRGATALSNATKSLST
YNYTAYRAYTLEGLTLAYNGYQLTKSAYLDVENTATLFSVLLVLFAFIMGLYFRKPGSSP
FSVIGKTLVVTAIPGIIFYFIHPALHLTANAIMTIIGFIMIILVIPALLVLLGDFNKALK
EIRRKIVGVHEVERSKLVAGYMSFSYGVEYMKKRRLRTLLTIITLIVVVISVVLFTSMTS
YVAPKPVALSGFEPIRPQGFLLQRETIDRNLPMGSQLYDLVKVIIGKDAVVRYWAVGSTY
LFLYDDPSKYYPINSITAVEPEEDVISNISKIIVKGRWFNSSDQYVAIIPATAINDTNGV
IDVNKTIVIAGVRFRIIGAYDDRRILEIRELDGQTITPVIGFPRARTVRTIFIPAKIAEI
NPWLNKGLSFYLAQISIKTGIDPFILGRDIVFILPSTDTYAYSPSHGVAKYSKMIALSGA
GFNYVVAPIIIASVSILGVLLGSIYERKREIFIYAALGLSPSQIGLMFIAEALAYALIAT
VVGYVTGILITTSAATFMPEIFRPNYSSEYVVLAIAATFISVLAATIYPVFKASKMALPS
LRRKWEFPTKPKGDEWVIPMPFKITSYKELIGSLYYVYEYISGFTSPDIGNFVIEKISIG
KTTMNGKNVVVLGGVVRLKPWHAGVKQEFQIRALEVNPNEWEISIYLKRLSGNTRLWIRS
NKFFIDALRKQLLLWRTITLDEKKQYIAKAESIIKV
Download sequence
Identical sequences D7D8Q7
gi|297527028|ref|YP_003669052.1| WP_013143351.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]