SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297527047|ref|YP_003669071.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|297527047|ref|YP_003669071.1|
Domain Number - Region: 26-140
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000548
Family GHMP Kinase, N-terminal domain 0.017
Further Details:      
 
Domain Number - Region: 220-276
Classification Level Classification E-value
Superfamily Nqo5-like 0.0445
Family Nqo5-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297527047|ref|YP_003669071.1|
Sequence length 280
Comment kinase (sugar kinase superfamily)-like protein [Staphylothermus hellenicus DSM 12710]
Sequence
MLIKIPLHISGLWYPIITNNPLTTGSIGAGINIALYLTAKLRNTEKCGIILNNEEVLKDH
SQTICGKLGANLYVDEKSPISLGYGFGVSAACLLGLSLSSLLIKNNTIEKATWPAHIAEV
IYNTGYGDVIAEFYGGVEIRVKPGPPGIGVVEHIYPGRKIDLIVSILPGREDTPKMLKRI
SRETYDLAKKLVEELLEKPSVEEFFEKARIFTSKIFSYDSIDELLSPYRSKIIGYFRKKQ
ALTLWVEKEWLDEIYSYLNKYFLTFKTWIDMYGVRFENPP
Download sequence
Identical sequences D7D8S6
WP_013143370.1.49614 gi|297527047|ref|YP_003669071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]