SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297527281|ref|YP_003669305.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|297527281|ref|YP_003669305.1|
Domain Number - Region: 103-137
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 0.0863
Family eIF2alpha middle domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297527281|ref|YP_003669305.1|
Sequence length 159
Comment hypothetical protein Shell_1313 [Staphylothermus hellenicus DSM 12710]
Sequence
MGNMRLLRKPPRIKVLEAIGSIGDQRVKVLDDHRAEVVSSRGDRVYKVIVEPVKHNVYHA
YSSDNGTIFRGYVGYPIIAFLMTKSVIPIDKEVMKAVTGVPWKDLNERYKKYSIVENIVL
NRAERMGVSREIIMDYINIVMKKLGLLKIYFVEELKNKF
Download sequence
Identical sequences D7D9G0
gi|297527281|ref|YP_003669305.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]