SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297527312|ref|YP_003669336.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297527312|ref|YP_003669336.1|
Domain Number 1 Region: 2-235
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.29e-46
Family RecA protein-like (ATPase-domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297527312|ref|YP_003669336.1|
Sequence length 249
Comment putative circadian clock protein, KaiC [Staphylothermus hellenicus DSM 12710]
Sequence
MVERVKTGIPGFDEIVNGGIPKRNVVLLSGGPGTGKSIFGTQYLWNGLQMGEPGVFVALE
EHPVQIRINMRQFGWDVRPYEQQGVFAIVDAFTGGIGEAAKREKYVVRDPTDVGELIDVL
KQAIRDVGALRVVIDSVSTLYLTKPAVARGVVLQLKRVLSGLGTTSILVSQVSVTERGFG
GPGVEHAADGIVRLDLDEYNGELVRSIIIWKMRGTKHSMRRHPFEITDKGIIIYHDKVVR
IKGGTALIE
Download sequence
Identical sequences D7D9J1
gi|297527312|ref|YP_003669336.1| WP_013143635.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]