SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297527341|ref|YP_003669365.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297527341|ref|YP_003669365.1|
Domain Number 1 Region: 10-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000751
Family GHMP Kinase, N-terminal domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297527341|ref|YP_003669365.1|
Sequence length 331
Comment beta-ribofuranosylaminobenzene 5'-phosphate synthase family [Staphylothermus hellenicus DSM 12710]
Sequence
MPISILITTGARLHLGFYNFLSEGKAYGSIGVYLKTPTIRVLGIREGDNLRIHNYTGINI
DDIVYTINNIFKNYGVSIHILESFPRHVGLGSTTQILLAIGDCIRRIYNLRLSIRELALL
FKRGIVSGIGIATYEKGGLIIDSGRRAKNGIIGIPKDLDDLPSVIYRKNLPQHWYFIVIT
PKGIKGLDEKSETPFLEKPEENKELQYELLKILVLKLLPSISNNDPKTFGRAIYKIQLLT
GKYFSKYQDSIFCCEEAEYIINSLMRNGVYGAGQSSWGPTVYGIIDYRKKALRTLSRVKQ
ELYHRDIEADYYISQVSNTGARVSRIRDYKF
Download sequence
Identical sequences D7D9M0
WP_013143664.1.49614 gi|297527341|ref|YP_003669365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]