SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297527351|ref|YP_003669375.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297527351|ref|YP_003669375.1|
Domain Number 1 Region: 13-145
Classification Level Classification E-value
Superfamily Prefoldin 0.0000000000000235
Family Prefoldin 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297527351|ref|YP_003669375.1|
Sequence length 159
Comment prefoldin subunit alpha [Staphylothermus hellenicus DSM 12710]
Sequence
MSKEIREKRTTVTLTELIARANELREHMNVLQTQIETYTSQLSELQLVKNTLEELPTSTF
DGLVVLDRLNTAFIPVRISDNWDKNIIVNIGRNYYVRTNKDKASKIVSDRISVIRRILND
LRRQYQAVLMEYNTIQQILAKIYAQAQQSQQASQRKGAS
Download sequence
Identical sequences D7D9N0
gi|297527351|ref|YP_003669375.1| WP_013143674.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]