SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297527530|ref|YP_003669554.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297527530|ref|YP_003669554.1|
Domain Number 1 Region: 1-75,163-338
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.81e-77
Family Pyruvate kinase 0.0000283
Further Details:      
 
Domain Number 2 Region: 318-453
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 7.69e-16
Family Pyruvate kinase, C-terminal domain 0.0076
Further Details:      
 
Domain Number 3 Region: 70-163
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.000000000000108
Family Pyruvate kinase beta-barrel domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297527530|ref|YP_003669554.1|
Sequence length 469
Comment pyruvate kinase [Staphylothermus hellenicus DSM 12710]
Sequence
MRKVKIIATIGPSSGKYDVLTRLIQEGVNGFRINFSHGDPREWDEWVKMVREIAEEYEQE
ISIMGDLPGPQVRIGELPVHGIKAKQTVKLIYKDKVDEENTIPIPNKKVFEILELGDIIL
IDDGKIILRIIDISGNEAEAIVLNDAVLHPHKTLVVFGKEIDLPVLSEKDIDLVNYSVSR
KLTYLAISFVRRASDIVIVRDIVSRMNGEIGLIAKIETRSAVRNLKDIMNVSDAIIIARG
DLGMHYSLEELPALQRKIAREAIMVGKPSIVATQLLESMVNYPRPSRSEVVDVVNAVYDL
VDALLLTDETAIGKYPVESVKWLKRIISSAESSIVKRRIEDTREKLELRALREKYALGLT
LLAEKINAKTLIYTKTSTIPPAISRFRPQIPVYVGTSDKLIAEKLTIYYGLKPYYLKQLR
NKDVDYEQGVKTLYEYLKNKEEIAYGEIIAEAYGRRETQIHEIKIRQVI
Download sequence
Identical sequences D7DA59
gi|297527530|ref|YP_003669554.1| WP_013143853.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]