SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297527564|ref|YP_003669588.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297527564|ref|YP_003669588.1|
Domain Number 1 Region: 10-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.57e-71
Family G proteins 0.00000335
Further Details:      
 
Domain Number 2 Region: 468-628
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.2e-53
Family Translational machinery components 0.0000186
Further Details:      
 
Domain Number 3 Region: 260-383
Classification Level Classification E-value
Superfamily Translation proteins 5.11e-30
Family Elongation factors 0.00099
Further Details:      
 
Domain Number 4 Region: 392-468
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 7.91e-22
Family EF-G/eEF-2 domains III and V 0.00044
Further Details:      
 
Domain Number 5 Region: 629-724
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.26e-21
Family EF-G/eEF-2 domains III and V 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297527564|ref|YP_003669588.1|
Sequence length 736
Comment translation elongation factor aEF-2 [Staphylothermus hellenicus DSM 12710]
Sequence
MVRYKQTMEILKIMRNLDQVRNIGITAHVDHGKTTLSDSLLAASGIISEKIAGEALALDY
LDVEQKRGITVKSANISLYHEYKGKPYVINLIDTPGHVDFSAKTTRAMRVIDGAILVVDA
VEGVMTQTEMYLRAALEERVRPVLFINKVDRLIKELRLSPQEIQQRFVQIIKEVNQLIAM
YADKEFKTKWQLDPAKGQVAFGSARDRWGFTVPMAKQKGIKFSDIVDLYKKGKEALPELQ
KLAPLHEAVLDMVVKFIPNPREAQKYRLPKIWHGDLNSEIGKAMMETDPNGPVIMLVNDV
RIDPHAGLVATGRVFSGTLRAGEEVWLTNARMKQKVLQVSLYMGPYRELADEIVAGNIAA
VLGLDKARAGETVVAVEYKDAMTPFEKLRMISEPVVTVAIEPKNPRDLPKLIDALHKLSI
EDPSLVVRINEETGEYLLSGMGPLHIEIALTFLRENYGLDVVASQPIIVYRESIRDKSKV
FEGKSPNKHNKLYISVEPLDEKTISLIHDGIITEDMDAKQRAKVLREEAGWPTDQARRIW
AIDENINVFVDLTTGVQHLREVKDTIIQGFRLAMREGPLAMEPVRGVKVILHDAIIHEDP
AHRGPGQIYPAVRNAIYAGMLTARPTLLEPIQKLDIKAPMEYLGNITTIITKKRGKILQV
LQQGAVARIVAEIPVAETFDLAEQLRGATAGKAIWGQEFSRWAPIPDSMLLDLIKKIRER
KGLKPEPPRPEDFIGF
Download sequence
Identical sequences D7DA93
WP_013143886.1.49614 gi|297527564|ref|YP_003669588.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]