SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296107557|ref|YP_003619258.1| from Legionella pneumophila 2300/99 Alcoy

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296107557|ref|YP_003619258.1|
Domain Number 1 Region: 198-353
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 6.8e-79
Family RalF, C-terminal domain 0.0000000777
Further Details:      
 
Domain Number 2 Region: 4-194
Classification Level Classification E-value
Superfamily Sec7 domain 1.23e-59
Family Sec7 domain 0.0000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296107557|ref|YP_003619258.1|
Sequence length 398
Comment guanine nucleotide exchange protein [Legionella pneumophila 2300/99 Alcoy]
Sequence
MHPEIEKAQREIIEAFNAKPKNGIKKIKEICGEYKISPNEEIAAFFHQQRKNLDLEAVGD
YLSEPEAENQQVLKAFTSQMDFNGQSFVEGLRIFLKTFKLPGEAQKIDRLVQSFSGAYSQ
QNPGVVSNADAAYLLAFQTIMLNTDLHNPSIPEKNKMTMDGLKRNLRGGNNGEDFDAKFL
EELYSEIKAKPFELNFVKTSPGYELTSITLNKDSTFKKLDSFLHSTDVNINTVFPGIGDN
VKTTVDQPKSWLSFFTGYKGTITLTDKQTSAQATIQVYTPNIFSKWLFGEQPRVIIQPGQ
TKESIDLAAKIAAGFSSPVKNFKATYDYEAGDLIKAYDNQKKLISTNKNTVIKGAMFRTP
NAEQQETSKSATKTLNTDYDINEDTETIKDESKSSYKK
Download sequence
Identical sequences A0A129G120 A0A1S8GHH6
400673.LPC_1423 gi|296107557|ref|YP_003619258.1| gi|148359513|ref|YP_001250720.1| WP_011946858.1.10632 WP_011946858.1.1206 WP_011946858.1.17430 WP_011946858.1.21168 WP_011946858.1.23 WP_011946858.1.24659 WP_011946858.1.24881 WP_011946858.1.29425 WP_011946858.1.30122 WP_011946858.1.31301 WP_011946858.1.32367 WP_011946858.1.34671 WP_011946858.1.37078 WP_011946858.1.37792 WP_011946858.1.47329 WP_011946858.1.49404 WP_011946858.1.50792 WP_011946858.1.51024 WP_011946858.1.51991 WP_011946858.1.5252 WP_011946858.1.5363 WP_011946858.1.58590 WP_011946858.1.59692 WP_011946858.1.61570 WP_011946858.1.6243 WP_011946858.1.63686 WP_011946858.1.68780 WP_011946858.1.72722 WP_011946858.1.74052 WP_011946858.1.76246 WP_011946858.1.82004 WP_011946858.1.86462 WP_011946858.1.87225 WP_011946858.1.93995 WP_011946858.1.9568 WP_011946858.1.98163 WP_011946858.1.98579 WP_011946858.1.98841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]