SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPI00000019393 from Pythium irregulare DAOM BR486 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPI00000019393
Domain Number 1 Region: 227-346
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000403
Family RNA methyltransferase FtsJ 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPI00000019393
Sequence length 394
Comment pep:novel supercontig:GCA_000387425.2:pir_scaffold_424:10009:11271:-1 gene:maker-pir_contig_424-snap-gene-0.14 transcript:EPrPIT00000019393 description:"Ribosomal RNA large subunit methytransferase J."
Sequence
MAPPQQRTNTPSTRRKLHAASTAQPQIALCPCIAVHTEETQLQRFADRLCSFQLPPVLAQ
AVHHVEVVAVASPLIYARLQLQRDGNYGSGASHGEMSSASELNAVLHEYTEEQFGRGRIH
AHRVYQLDWSCADPEWIPMAAPILALKQRSIFRVVAFPKQLQDKMTVLLHTHGFETHPKQ
FTHELYVVMQPSLSPYFHFGVSAPSSRAVTSHGENEPVQAFATVAADAPCRAYFKMEESL
HYVTLKPGDRVIDVGASPGGWTECLLNHGAQVVAVDPGELTIDLEDKPVVHLQMLLEDAK
THLQRMDTKFAMCVCDINIRVAHMAELMASIGHLLLPNAHVVFTLKLGKKPTQQVIQQSF
DVACAILQPSFHDFRMLWLHANTQNERTLVAVKR
Download sequence
Identical sequences EPrPI00000019393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]