SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPI00000024180 from Pythium irregulare DAOM BR486 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EPrPI00000024180
Domain Number - Region: 3-45,86-112
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00667
Family Pseudo ankyrin repeat 0.036
Further Details:      
 
Domain Number - Region: 38-96
Classification Level Classification E-value
Superfamily Jann2411-like 0.0314
Family Jann2411-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPI00000024180
Sequence length 134
Comment pep:novel supercontig:GCA_000387425.2:pir_scaffold_1604:3090:3542:1 gene:maker-pir_contig_1604-snap-gene-0.3 transcript:EPrPIT00000024180 description:"Conserved gene of unknown function."
Sequence
MAKWLHECGYPFSTEAIDGAVANGYKGVVKYLHEHRSEGCTMDAMRLAAGGIFLDVVEFS
WEASPGRLPARCCEYSILDCIFQVRNFSRNRNLRWCAEVLTSFISLDIASCSITQHMNDG
RPRRCQKKKKKQSG
Download sequence
Identical sequences EPrPI00000024180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]