SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPI00000014035 from Pythium irregulare DAOM BR486 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPI00000014035
Domain Number 1 Region: 142-401,447-522
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.18e-57
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00037
Further Details:      
 
Domain Number 2 Region: 24-114
Classification Level Classification E-value
Superfamily RING/U-box 2.35e-19
Family Zf-UBP 0.0055
Further Details:      
 
Domain Number 3 Region: 408-445
Classification Level Classification E-value
Superfamily SAP domain 0.000000915
Family SAP domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPI00000014035
Sequence length 524
Comment pep:novel supercontig:GCA_000387425.2:pir_scaffold_29:2144:4623:1 gene:maker-pir_contig_29-snap-gene-0.16 transcript:EPrPIT00000014035 description:"U4/U6.U5 tri-snRNP-associated protein."
Sequence
MSKRSFEESGGDANGSAHDAKRRKCPYLDTINHQMLDFDFEKVCSISLSDQNVYACLVCG
KYFKGRGKATHAFTHSVQSAHHVFINLQNDKIYCLPDNYEVVDHCLKPIKDALRPSFEPA
QIAKLDQNRILAQDAFGVSYLPGFIGLNNLKNTDYINVVVQALAHIPPLRNFFLQALPEV
TKSKSQLVHRFAELLRKMWSPHNFKNTVKQPIHPSPHCSVPISPHEFVQEVSVSSKKRFH
VGKQNESVEFLSWLLNELHRGLGGSSKPGSSIIHKCFQGFIEVTTIDESKAAEPATSGNS
PFLLMSLDLPSTPLFKDSQGGNIIPQVPLFTVLEKYDGTHVTHILQGSQRLKKTYKIESL
PPYIIFHVKRFTRNNFFTEKNPTIVNFPVKNLELREYLNLDESIPTAEELANMSISDLRA
ILSKHKVSSKDCVEKSDLVEKVMQVTVPSTKYNLISNIVHDSPVTTGKEAALKTNPLTEG
SYRVHVQNRATEQWYEIQDLHVQETMPQLIGVSESYMMVYERKE
Download sequence
Identical sequences EPrPI00000014035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]