SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPI00000017239 from Pythium irregulare DAOM BR486 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPI00000017239
Domain Number 1 Region: 173-440
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-26
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 46-123,157-192
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000301
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPI00000017239
Sequence length 516
Comment pep:novel supercontig:GCA_000387425.2:pir_scaffold_214:29306:30889:-1 gene:maker-pir_contig_214-fgenesh-gene-0.9 transcript:EPrPIT00000017239 description:"Ankyrin."
Sequence
MKGYPLAVFKFYRESDTAALQSACEKWHGKQAFLIGNLTRRGVLPHLAIAANDLEMFKAL
IKLSKNHQYQRDPKLSFSKAMRCAVVFNRLDMLKCLAELKAEDVEWKWEPNLMRLALQRD
DPDLQALDWLFEHLPRKTNPIYGQDTLRHAQRGDLGAVRWLHEHTHKIPQRVIDEAANSG
QAEVLRYFYEHSDRRCRANAVNRAAELGYMEVVKLITENQTRETSQYALDWAATTGQLEV
IKYLLKSKARLTTATVAETAARNGHLDIMKWLHEHQFGGFTAQTMTSAAANGHLETMEFL
HENHTEGCPSDALDLAARRGYLEVTKSLHDKYALKCSVRAFDRAAARGCLDMITFLHRTK
LTSGTANATIWAAKHGHCEIVKFLCDHNLERDVASALASAASRGHLDVVQLLLPRLETEA
SIYEAFAAAVRRKQRAVVKYLAKSQQRESASIVKQAVAKSDAAVVGAVWAYTSPEDLIDA
QELAVKLHDDRIAHLLTRGIEVHEWKTKTRRLNSSE
Download sequence
Identical sequences EPrPI00000017239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]