SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPI00000021473 from Pythium irregulare DAOM BR486 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPI00000021473
Domain Number 1 Region: 217-355
Classification Level Classification E-value
Superfamily Bet v1-like 2.18e-34
Family STAR domain 0.0092
Further Details:      
 
Domain Number 2 Region: 1-111
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-16
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPI00000021473
Sequence length 667
Comment pep:novel supercontig:GCA_000387425.2:pir_scaffold_733:2475:4828:-1 gene:maker-pir_contig_733-fgenesh-gene-0.1 transcript:EPrPIT00000021473 description:"Lipid binding protein."
Sequence
MEGWLTKRRDHMNLIWLERYFVLDGNQMRYYRKRGDPAPRGTYVLTDGCLVSNVFNSEEK
HRHHGPVWMFRITFAVEAGEKSYKKDRFLDLGAKTEENAREWKKAIENAVRSLRELVLHQ
RKMKTDAAIYPTQYSVPRLLKADEDTVSLFNLDADNVKAEQGWWLARVEEGLRIMQECPL
GPNVAASLYAQHANTTNGLIFSSLISAILTFSIMYSFIPSFRVSQVVNGSPTEVFRLLMN
PKRYQRWDPSIATMKVIQEMDDHADIVYITQRPTYLWPLWQKPRDLVLMRYWRREEDGSY
FVMYQSIEHPECRVRHNYVRATLLGGGFVIAPQKVPSGAIRSHVTYVLRYDPGGWSRIYH
QLGMDVDLVMPMLRSVVGIRDELSSVDFITPNVTVAATGADGSVVSEGQEGAGGNSSDAI
NTVSVDASGVVVGVTKLKTSLPEKMWSEPDASVFQVRGPNYLIDKKKMPSAESKFHLVGV
DLLSFESASDRYHVSSRNGSIGRTSTKFTFVINMIIPGAENVCMVFYFQPAKDNIFEDGS
PFSELLNDFIDGDDQFRNSRFKLIPTVVEGSFIIKQSVGSKPTLLGNKLKCPYHKGENYF
EVDIDISSNSVANTVVGMVQGVTKSLVVDMAFLLESQSEEELPENILGAVRLQNISLDKP
LRVPKST
Download sequence
Identical sequences EPrPI00000021473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]