SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPI00000023337 from Pythium irregulare DAOM BR486 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPI00000023337
Domain Number 1 Region: 631-828
Classification Level Classification E-value
Superfamily Sec7 domain 7.46e-67
Family Sec7 domain 0.00000359
Further Details:      
 
Domain Number 2 Region: 151-262,419-589,929-1042,1231-1297,1339-1399,1500-1663
Classification Level Classification E-value
Superfamily ARM repeat 2.02e-17
Family MIF4G domain-like 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPI00000023337
Sequence length 1982
Comment pep:novel supercontig:GCA_000387425.2:pir_scaffold_1222:426:6462:1 gene:maker-pir_contig_1222-fgenesh-gene-0.0 transcript:EPrPIT00000023337 description:"Brefeldin A-inhibited guanine nucleotide-exchange protein."
Sequence
MEAQVLKSLAKLRKITTRSHKELRDVIDAAQAAMTAVVEKKNKPDAGSVNAGVGGGIGGT
TEVPFEPFLLACLTRHAKLVAVALDCIEKFLAFGFLRGNGSIPDGIRKRLVQKSTGPSGA
SSSSGARSGGGGGDANDGLEGGNGAGSSLNEENWKLIDCIVDVICDCNDHPDETVQIQVL
RVLLTAVTTTTCEVHEHSLLKAVRACYHIHLVSKNATNQTVAKATLQQIISIVFQRMETF
DQRVQEETEATLKESLQKSEAAAAAAAEAGRHENDDAELIAAPTASWYPSVVRVLQLDIE
IQNGSASASHSANGRGNIGVAASNAPIFAPSFPSVLHKDAFLLFRSLCRISMRSVAEDYA
LSSGGGMLSNGGALGGSSSNGSGGSEDPFAFQSKILSLELVLSIINNAGPSFRRGERFIH
AIRQYLCQSLLQNCTSNYTQIVGLSLQVFLVLINNFKLHLKAEIEIFVTSIFLKILQSEN
SSFEHKMLVLEVLNNICDDAQILGEIFLNYDCDWNTNDLFKQIIDALAKIAKGKKESNAH
ANLSSTLRLKAQQNDAAIVLKGLECLTATVASLKKAANFIEAEKKNSQQRTNSGSNHADG
DDDGASPPAVVPNASLASAPSTMSAVEAFDRKKKRQEELANGILKFNVKPTAGVQYLIQH
GHMGEGTPRDVARFFAEHSDKLDKTMVGDYLGRESQYQGGFCIRVLHEYVDMMDFTGLEI
DVAIRQFLAGFRLPGESQKIDRMMEKFAERFYAACPPGLFPSADTAFILSFSIIMLQTDL
HNPSISEEKKMTKEGFFRNNRGINNGEDLPEEYLGGIFDRIKATPISLKEDEDFRARRKM
AGGVKAVAATTLFGSSGATVDRQRRDAYIKERESMVRQSEALFKRRNPAGMGASSRGMTN
SPRSSNPIVSGGGTQNSPQFHLVTELTENSHVRPMFETVWAPLLACCSVIFESSDSPVAI
QLCLNSFKHAIHLASRLNMPSERDAFVTVLSKFTALHNTGSRLLRSKNIEAVKALISISV
KEGNYLGDAWRDILQCISQLARIQNHAQGLHSDTQFFNHQSSPAGSATSSIGGFSSTPTH
SSSSLSIGLSKRTHSASTSTFPSPSHRESSNGGGPGGEDLYNPAIEDENAARVMAEIDSL
ASDRVFSSSISLNDTAVQEFVLQLCVVSLTECSGVSNGRSSRQDNSFSPPRVFSLQKLVE
VADMNMHMRSRVIWASTWKVLSRHFTTIGCHDNLSIAMYAIDSLRQLSMKFLEREELKDF
NFQRLFLAPFEVIMANAVSMEIRELVLRCVENMILARVTNIKSGWKTIWGVLRVAAETYE
PGNGDHQDRIVQLGFQIAKRIFENHFERIVEVFVDAVECLLAFAVCGSEEVEKNMDEHMG
LTQLSIESIGILQNVCMEKLATGQVIEKLFVEASVPKRVGFRTKKKANSISVPGSEELVS
SPSGRASVRYERQESSRTLEEEISVLSPPSTPTRRSSVTTTAAAATLGEDAASVYNDSSA
HTRMWWPVLTALSTLAADCRIDVRLFALHGLYDSLESHGLKFSTGLWSLIFKGVLIPLLD
ELRHLEVFVERGKRVKPKLPLPSHSPSRIQYSAGKATSTFCLERLLECFGLFYDIVGFLP
EVLFLLGKCMDTNDTEEELASASAASLEKMLVAHGHKFPDDVWGLIADELRSVMTRAEPT
WIFFSMVTGNKAAAASPPPAPVSPVSPASPISPSSAGLMSPRQPSIISMYPSVVGVLGFK
FNKHFPPKVVTEEEVNAQQFPSKTHLTVILALQKVMGNVLASRFSRCLALSDGHVASLMT
CLRESFLFARKVNDAFELRLHLQKCGWTYGRTEAGDIPSLLLQEVQGKEQYLSVLFHLIR
EQHAVIDERKREDARRQMTQLVKQAVEEYLTWTVDPASSSFQFNVKTPADARQRTVRYVA
LIVSILQELSEFDGPEIRCHLAWLYPLLNELIKTPNGQVRVALTLVYDKSIRQLLPLQQA
QR
Download sequence
Identical sequences EPrPI00000023337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]