SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPI00000026357 from Pythium irregulare DAOM BR486 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPI00000026357
Domain Number 1 Region: 38-82
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000118
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 2 Region: 85-132
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000485
Family Ovomucoid domain III-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPI00000026357
Sequence length 166
Comment pep:novel supercontig:GCA_000387425.2:pir_scaffold_4281:506:1006:1 gene:maker-pir_contig_4281-fgenesh-gene-0.0 transcript:EPrPIT00000026357 description:"Four-domain proteases inhibitor."
Sequence
MNPQAIASLLLLATTLVASSLPVAAAAVNATESNNGHCELACLTIWDPVCGSDGKTYSNE
CFRRAEACKNPALTTKSPGECPDPCAKACTKEYKPVCSYDGVMHTQHPNQCELGIAKCQA
SKNDAKFEQKGCPTNKPLCGHMYYCGDAQKCIKDPAQQDSYYCASV
Download sequence
Identical sequences EPrPI00000026357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]