SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297626388|ref|YP_003688151.1| from Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297626388|ref|YP_003688151.1|
Domain Number 1 Region: 8-267
Classification Level Classification E-value
Superfamily Cgl1923-like 8.89e-66
Family Cgl1923-like 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297626388|ref|YP_003688151.1|
Sequence length 345
Comment hypothetical protein PFREUD_11990 [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
Sequence
MIDPTTLFSYEPTIDQRTIHDRVMVVTLGSFGDVGASQAQVDEHLLNTLTHRKIGTFDVD
QIMDYRGHRPPIDFDQDHYDNYVPPSMTLHEVVDKSGNPFLLLTGPEPALQWERVSATIE
WLMDQMDVQLVVTAQGVPMPVPHTRPINLLKVATRPELIPGNRGSGSFRMSSSFLAMMTQ
RLGEKGRDVIGLVARVPQYLADTEYPDGAIAMVNGLNELAGLNIPVASLEQASHLARAQI
DAQVEQSEELQQMIGQMEEQYDRYMQDHSLPMNEEDIPDADEIGQEMEDYLASLDPGTPD
SDKGPQVGPVDHDEDEHHSDRPGDNGPRDGHDGPQPPADPDIPND
Download sequence
Identical sequences A0A2C7ZEW3 D7GDW0
gi|297626388|ref|YP_003688151.1| WP_013161095.1.12274 WP_013161095.1.1730 WP_013161095.1.29476 WP_013161095.1.30516 WP_013161095.1.58907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]