SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301054804|ref|YP_003793015.1| from Bacillus cereus biovar anthracis str. CI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301054804|ref|YP_003793015.1|
Domain Number 1 Region: 133-177
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.000054
Family Surp module (SWAP domain) 0.0045
Further Details:      
 
Weak hits

Sequence:  gi|301054804|ref|YP_003793015.1|
Domain Number - Region: 85-186
Classification Level Classification E-value
Superfamily MAPEG domain-like 0.0589
Family MAPEG domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301054804|ref|YP_003793015.1|
Sequence length 240
Comment hypothetical protein BACI_c32600 [Bacillus cereus biovar anthracis str. CI]
Sequence
MKLVIPKQHGAWAMLVIPFLLSVILGKPTIYHIPLFIAWFFIYLATYPFLMYIKQKRKKE
YLHAAIVYFIIAFVFGMISLLYEWRILLFVAVMIPFFIVNMYYARQKNERALLNDISAII
VFCIGGLVSYYFSMKLIDKTALFIALISFLYFLGSTFYVKTMIREKNNPKYRFISWGYHI
LLMIIVFAINPWCSLIFIPSVIRAIILYGKKISIIKVGILEIVNSVYFLIITAIIMKYAI
Download sequence
Identical sequences A0A242WEN9 A0A243CUE3 A0A2C3GRU5 C3GBL7 D8H4Q2
gi|301054804|ref|YP_003793015.1| WP_000779965.1.100409 WP_000779965.1.15163 WP_000779965.1.16156 WP_000779965.1.30216 WP_000779965.1.33536 WP_000779965.1.46549 WP_000779965.1.53879 WP_000779965.1.55968 WP_000779965.1.56318 WP_000779965.1.56580 WP_000779965.1.59173 WP_000779965.1.60841 WP_000779965.1.63611 WP_000779965.1.64491 WP_000779965.1.67239 WP_000779965.1.7096 WP_000779965.1.71895 WP_000779965.1.85901 WP_000779965.1.90155 WP_000779965.1.90596 WP_000779965.1.93893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]