SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301068195|ref|YP_003786966.1| from Bacillus cereus biovar anthracis str. CI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301068195|ref|YP_003786966.1|
Domain Number 1 Region: 1-153
Classification Level Classification E-value
Superfamily Anthrax protective antigen 2.48e-40
Family Anthrax protective antigen 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301068195|ref|YP_003786966.1|
Sequence length 204
Comment protective antigen-like protein [Bacillus cereus biovar anthracis str. CI]
Sequence
MNILVRDPYHYDNNGNIVGVDDSYLKNAYKQILNWSSDGVSLNLDEDVNQALSGYMLQIK
KPSNHLTNSPVTITLAGKDSGVGELYRVLSDGTGFLDFNKFDENWRSLVDPGDDVYVYAV
TKEDFNAVTRDENGNIANKLKNTLVLSGKIKEINIKTTNINIFVVFMFIIYLLFYIISST
VFAKSCNCILIYVEVSQLMNSVFY
Download sequence
Identical sequences D8HA88
gi|301068195|ref|YP_003786966.1| gi|10956358|ref|NP_052807.1|NC_001496 gi|301068195|ref|YP_003786966.1|NC_014331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]