SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397772305|ref|YP_006539851.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397772305|ref|YP_006539851.1|
Domain Number 1 Region: 4-87
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.96e-33
Family Imidazole glycerol phosphate dehydratase 0.00013
Further Details:      
 
Domain Number 2 Region: 89-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.02e-28
Family Imidazole glycerol phosphate dehydratase 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397772305|ref|YP_006539851.1|
Sequence length 195
Comment Imidazoleglycerol-phosphate dehydratase [Natrinema sp. J7-2]
Sequence
MSERTATVTRTTAETTIECTLELDGSGTATVETGIGFFDHMLTSFAKHGLFDLEVDCDGD
LEIDDHHTVEDVAIVLGEAIDDALGDRAGIVRYADRRVPLDEAVAGAVVDVSGRPRFYFH
GSFSQARIGGFTSDMARHFAESLAMNAGLTLHLEVDGENAHHEVEALFKALARSLDDATR
RDERREGTPSTKGTL
Download sequence
Identical sequences I7BSJ1
WP_014862933.1.66429 gi|397772305|ref|YP_006539851.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]