SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397772833|ref|YP_006540379.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397772833|ref|YP_006540379.1|
Domain Number 1 Region: 12-215
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 1.96e-53
Family NADH oxidase/flavin reductase 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397772833|ref|YP_006540379.1|
Sequence length 229
Comment cobyrinic acid a,c-diamide reductase [Natrinema sp. J7-2]
Sequence
MVAFTPAERDAVYKAIYTRRDIRRFRDEPVPDAVLERLIEAAHHAPSVGFSQPWDLIVVK
DEGTKNDIAAIAERAIAAAREGYEEPRRSEFADLKLEGIRESPVNVCVTCDPTRGAPHVL
GRSSMKRTDVYSTCLAVQNLWLAARAEGVGVGWVSVLYPYEVQEVLDIPPHVKPIAYLCL
GYPEDGFPEEPVLQQEGWRDRLEVERLVHEEQWNADRASADRREPTTHS
Download sequence
Identical sequences I7CQJ6 L9ZA02
gi|397772833|ref|YP_006540379.1| WP_008452665.1.263 WP_008452665.1.60908 WP_008452665.1.66429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]