SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397772874|ref|YP_006540420.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397772874|ref|YP_006540420.1|
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.66e-35
Family Translational machinery components 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397772874|ref|YP_006540420.1|
Sequence length 132
Comment 30S ribosomal protein S9P [Natrinema sp. J7-2]
Sequence
MVTNTSGKKKTAVARATVREGEGRVRINSQPVELVEPEMSRLKMLEPFRIVGEDLRGEMD
IDVRVEGGGISGQADAVRTAIARGIVQHSNDAELRDAFMEFDRSLLVNDVRQSEPKKWGG
PGARARYQKSYR
Download sequence
Identical sequences I7CFT5 L9ZB72 L9ZKJ6
WP_007109449.1.263 WP_007109449.1.36753 WP_007109449.1.55490 WP_007109449.1.60908 WP_007109449.1.66429 gi|397772874|ref|YP_006540420.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]