SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397772954|ref|YP_006540500.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397772954|ref|YP_006540500.1|
Domain Number 1 Region: 20-203
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 5.63e-44
Family NADH oxidase/flavin reductase 0.00000904
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397772954|ref|YP_006540500.1|
Sequence length 205
Comment nitroreductase [Natrinema sp. J7-2]
Sequence
MQDSPETGRELSDEVAEHREPDHDIDPLFVNRWSPRAMTGDPLDEAAYLPLFEAARWAPS
AFNNQHWRFIYASREDDEWETFLDLLSENNQTWASDAAVLTVIVSKTTFDHNGEPAPVHS
FDTGAAWENLALEGARRGLAVHGMAGFDYERAADALDIPDEYAVEAMVAIGERAPAETLP
EELQEREQPSDRKPLAETLHRGGFE
Download sequence
Identical sequences I7CG08 L9ZCJ1
gi|397772954|ref|YP_006540500.1| WP_008452873.1.263 WP_008452873.1.60908 WP_008452873.1.66429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]