SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397773648|ref|YP_006541194.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397773648|ref|YP_006541194.1|
Domain Number 1 Region: 198-244,278-360
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 0.00000644
Family NADH oxidase/flavin reductase 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397773648|ref|YP_006541194.1|
Sequence length 368
Comment hypothetical protein NJ7G_1878 [Natrinema sp. J7-2]
Sequence
MTRTVEYTRNELLSVTTEQAGRTEEPSLLAIDPLATRTFELSSAEVLRGLAEIDGRHSRD
ELEETLLETLDLSADAAADLVADLIEAGFLRPADRHGSRTASWGATGWRAALEYHEYIRD
YPFIDEAVENSDYEDVKGMETEIMREYRAREEPPAIYKDYDIDERIELPPVEEAERVSVA
DALSTSLFGRADSTRDALDARTLAAILYFAFGETGKLQTEHQGPKLRKPVPSGGARHPTE
GYVAVFEAADLPAGIYHYSVREHALERLPTDTDPEKPLLWGIDSDPAALIGCTSVVERSM
WRYREPRTYRVLLHDLGHVLETLRITARAAGLTTMAGFKFDDEYLEDCFGVDHAEEPLLA
YAALSTDP
Download sequence
Identical sequences I7CSQ0
gi|397773648|ref|YP_006541194.1| WP_014863987.1.66429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]