SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397773756|ref|YP_006541302.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397773756|ref|YP_006541302.1|
Domain Number 1 Region: 4-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000311
Family GHMP Kinase, N-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397773756|ref|YP_006541302.1|
Sequence length 275
Comment GHMP kinase [Natrinema sp. J7-2]
Sequence
MREEATAFVPGHVTGFFSAHPDEDPTKAGSRGAGLTLTDGVEVSVEPATESTVVLDGTEA
EVEPVTTVLETLDATARVEAAADLPIGAGFGVSGAMALGTALAANRVFERKLSANELVTI
AHGAEVQAGTGLGDVVAQAHGGVPIRLEPGGPQDNKLDAIPSRARVEYVSFGELSTADVL
SGDTEALTAAGKEALARVVEEPTLLSFMYASRLFARDAGLLTERVTETIAEVSEAGGQAS
MAMLGETVFALGTGLSDAGYEPSVCATHPAGAVLK
Download sequence
Identical sequences I7CWS7 L9Z6W9
gi|397773756|ref|YP_006541302.1| WP_008454241.1.263 WP_008454241.1.60908 WP_008454241.1.66429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]