SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397773823|ref|YP_006541369.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397773823|ref|YP_006541369.1|
Domain Number 1 Region: 46-117
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 8.06e-20
Family Ribosomal S5 protein, N-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 130-204
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.33e-19
Family Translational machinery components 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397773823|ref|YP_006541369.1|
Sequence length 219
Comment ribosomal protein S5 [Natrinema sp. J7-2]
Sequence
MSGNNYNDGGWQPVTRLGRKVQEGDIETMEDALNSGLPLKEPELVDQLLPGLEDEVLDIN
MVQRMTDSGRRVKFRCVVAVGNRDGFIGYAEGRDDQVGSAIQKAIGIAKLNMIQVPRGSG
SWEDRSDRPHSLTRRTTGKAGSVEVEVIPAPEGLGLAASDTVRHVLELAGIENAWTKSHG
NTRTTVNLAKATYNALENASQSRHPRRRPNREDAEVADQ
Download sequence
Identical sequences I7CT47 L9Z854
gi|397773823|ref|YP_006541369.1| WP_008454354.1.263 WP_008454354.1.60908 WP_008454354.1.66429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]