SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397774234|ref|YP_006541780.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397774234|ref|YP_006541780.1|
Domain Number 1 Region: 2-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.87e-29
Family GHMP Kinase, N-terminal domain 0.0000613
Further Details:      
 
Domain Number 2 Region: 152-269
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.91e-24
Family Homoserine kinase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397774234|ref|YP_006541780.1|
Sequence length 292
Comment homoserine kinase [Natrinema sp. J7-2]
Sequence
MRAPATSANLGSGFDVFGVALGTPADVVRVERASRTTITVTGAGSQYIPEDPAKNTVGAV
AEALDAPARIRIDKGVRPSSGLGSSAASAAAAAVALNELYDRGRSRAELVPVAAEGEALV
SGEAHADNVAPSLLGGFTVVTDDGVTHVDASVPVVACLPEISVSTRDARGVVPDTASMDE
VVDTVGNAATLTVGMTRDDPVLVGSGMADEIVTPERTKLIDGYESVREAALEAGATGVTV
SGAGPGMLAVCHRRDQRAIASAMVDAFDAAGVESRAYQTAVGEGATLYRDGA
Download sequence
Identical sequences I7CJ55
gi|397774234|ref|YP_006541780.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]