SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397774340|ref|YP_006541886.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397774340|ref|YP_006541886.1|
Domain Number 1 Region: 236-412
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000196
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397774340|ref|YP_006541886.1|
Sequence length 416
Comment hypothetical protein NJ7G_2580 [Natrinema sp. J7-2]
Sequence
MATQDTRPRGGFVSFVRDYTKTWVHAVATAGLTAFGTLAVFHRGFIALALATYIVPPIVL
YLWRPSAGRNDGDTAAEGNGDAAAEGEADAAIAGRGGRSLERAGAERAAATAAEADRGAD
WHLVDVPTDATLRDVCITDAGAVYAVGENGLVLAGAPADGPGTDAWSIVLEDGPAAAGDE
LTGVDATDGGEAVWVAGDSGSLGRLEAETGRHTDYTAPTDITDNWVGVAVGGASGDETVL
LSTGSGAVLRGRYRDGECAWDDPITPGSGASLSAIALADASVGYCCDTNDGVFETTDGGR
SFDRVGLEGAGGTLENLATLGRGDCLVSDDDGVVHRYGGSTWTPERVGDAAICGITRREG
ETIVCDADGVLYERTRAAGWDRVGTQAPDALIAVSTATTGGRAVAVGEEGTVVERR
Download sequence
Identical sequences I7BXW3
WP_014864540.1.66429 gi|397774340|ref|YP_006541886.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]