SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397774877|ref|YP_006542423.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397774877|ref|YP_006542423.1|
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Vng1086c-like 8.24e-30
Family Vng1086c-like 0.0000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397774877|ref|YP_006542423.1|
Sequence length 92
Comment hypothetical protein NJ7G_3126 [Natrinema sp. J7-2]
Sequence
MHKDELLELHEELVVIMEYFSDREEVDETLFDPYRQLDVDPSHVHKSKSEHKHAVFVLGN
ALASAMSEDEFSSAGRIGKRMKELAEDAESKI
Download sequence
Identical sequences A0A2A5QWY1 I7BP06 L9YKF9 L9YT17 L9ZVN3
gi|397774877|ref|YP_006542423.1| WP_006186471.1.263 WP_006186471.1.31884 WP_006186471.1.36753 WP_006186471.1.55490 WP_006186471.1.60908 WP_006186471.1.66429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]