SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296127904|ref|YP_003635154.1| from Cellulomonas flavigena DSM 20109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296127904|ref|YP_003635154.1|
Domain Number 1 Region: 47-190
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.67e-45
Family Ribonuclease PH domain 1-like 0.000000383
Further Details:      
 
Domain Number 2 Region: 360-531
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.62e-44
Family Ribonuclease PH domain 1-like 0.000000448
Further Details:      
 
Domain Number 3 Region: 513-612
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.32e-23
Family Ribonuclease PH domain 2-like 0.0000159
Further Details:      
 
Domain Number 4 Region: 191-298
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.39e-23
Family Ribonuclease PH domain 2-like 0.0000248
Further Details:      
 
Domain Number 5 Region: 615-727
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.04e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 304-384
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 8.63e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296127904|ref|YP_003635154.1|
Sequence length 791
Comment guanosine pentaphosphate synthetase I/polyribonucleotide nucleotidyltransferase [Cellulomonas flavigena DSM 20109]
Sequence
MTRADLFAGSRIELLSTGPSQVSEAESERIREEVAQALRAHVPVQFAEATIDNGRFGTRT
VRFETGRLAKQAAGSAVAYLDDDTMLLSATTAGKHPREAFDFFPLTVDVEERQYAAGKIP
GAFFRREGRPSTDAILACRLIDRPLRPLFVKGLRNEVQVVVTVLSINPDDAYDVLAINAA
SISTQLSGLPFSGPVAATRLALVDGQWVAFPRYSERERSTFDIVVAGRVVGDDVAIAMIE
ADAPENAWNLIHGGGGTAPTEEVVAQGLEASKPFIKVLVEAQQQLAAQAAKETQTFPTFP
DYQPDAFAAVEQAASERLSAALQIAGKQERENRLDEIKGEVAGELAAQFEGREKEISAAY
RSLQKQLIRQRILTDGFRIDGRGLRDIRTLSAEVEVLPRTHGSALFERGETQILGVTTLN
MLRMEQQIDSLSPETRKRYMHHYNFPPYSTGETGRVGSPKRREIGHGALAERAIVPVLPA
REEFPYAIRQVSEALGSNGSTSMGSVCAATLSLLNAGVPLRAPVAGIAMGLVSDTVDGET
RYAALTDILGAEDAFGDMDFKVAGTREFVTAIQLDTKLDGIPASVLAGALTQAKEARLAI
LDVIAEAIDVPDEMSPFAPRVISVKVPVDKIGEVIGPKGKMINQIQEETGADISIEDDGT
VYIGATDGPSAEAARAAINAIANPHMPEIGERFVGTVVKTTTFGAFISLSPGKDGLLHIS
QIRKLVGGKRVENVEDVLAVGQKVQVEIGEIDPRGKLSLHAVLDEAQTEGDPADPPAGVE
VATATAYRINW
Download sequence
Identical sequences D5UFJ6
WP_013115289.1.68649 gi|296127904|ref|YP_003635154.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]