SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296130896|ref|YP_003638146.1| from Cellulomonas flavigena DSM 20109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296130896|ref|YP_003638146.1|
Domain Number 1 Region: 197-458
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-46
Family Protein kinases, catalytic subunit 0.00025
Further Details:      
 
Domain Number 2 Region: 535-687
Classification Level Classification E-value
Superfamily TPR-like 0.00000822
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 
Weak hits

Sequence:  gi|296130896|ref|YP_003638146.1|
Domain Number - Region: 156-194
Classification Level Classification E-value
Superfamily RING/U-box 0.0777
Family RING finger domain, C3HC4 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296130896|ref|YP_003638146.1|
Sequence length 785
Comment serine/threonine protein kinase [Cellulomonas flavigena DSM 20109]
Sequence
MTSATACREPGCTGTYEDGWCNVCGSPAPAGATSTSTGTTTPPTGAAAGAPTGATSAART
PSAMLGTGIAAGVPTPGAAGDPEAERSTRTGRTSSTRLPTAALGSARTAATGSRATRRLG
TSSTRLRRARLGAGLTTVPPAPVEDPLQAVMTDPQVPERKRFCAACGEPVGRARDGVPAR
TQGFCPSCGTRFDFDPKLTPGTLVGGQYEVVGCLAHGGMGWIYLARDRNVSGRWVVLKGL
LNSADPDAVAAAIAERQFLARVEHPLIVEIYNFVQHEGDGYTVMEFVAGRSLKELLTDRR
EAAGTVDPLPVDQALAFVLEVLPAFQYLHDVGLLYCDFKPDNVIQSGDALKLIDMGGVRR
IDDEQSAIYGTVGYQAPEVPTDGPSVASDVYTIGRTLATLVLDFRGNTTTYVAALPPVEE
TPVFARYDSFYRLLAKACAPDPSDRFGSVDEMRAQVLGVLREVVAADRGTGDPPLTSAAS
VLFEPPVTDQVERPLAWDELPHLKVDPDDPAAGWLAGVNVVDPAQRLAALADAPDETVEV
RLLRATTAIEAGRPEVVGQAVEAMLADDPWEWRAVWTQGLAQLAAGDAVAARASFNAVYG
QVPGELAPKLALAVACELSGEPGIAEQLYATCAYADANYTAPAAFGLARLRMASLHVDDA
LAALDLVTPTRSSYPQARLMRARVLARSRTDLASLAASLDSVRSVALAPADRAGLRVDVL
TTALATVRQGGSAPGVRLDGVETTERGVTDALEAAYREQAALTEDRAARVALVDRANAVR
RWTAW
Download sequence
Identical sequences D5UL65
gi|296130896|ref|YP_003638146.1| WP_013118278.1.68649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]