SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302038919|ref|YP_003799241.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302038919|ref|YP_003799241.1|
Domain Number 1 Region: 5-50
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000314
Family AN1-like Zinc finger 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302038919|ref|YP_003799241.1|
Sequence length 56
Comment hypothetical protein NIDE3637 [Candidatus Nitrospira defluvii]
Sequence
MPKARTAKNCYYCEAEDRIKMTFMLCGLCHRHFCSAHGVPDLEQCTKCLEASEETE
Download sequence
Identical sequences A0A1W1HX41 D8PJ79
gi|302038919|ref|YP_003799241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]