SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297618881|ref|YP_003706986.1| from Methanococcus voltae A3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297618881|ref|YP_003706986.1|
Domain Number 1 Region: 3-237
Classification Level Classification E-value
Superfamily Aquaporin-like 1.57e-62
Family Aquaporin-like 0.0000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297618881|ref|YP_003706986.1|
Sequence length 239
Comment MIP family channel protein [Methanococcus voltae A3]
Sequence
MSIVKKSIAEMIGTCFLVFFGTGSAIMALLISNSLGMPGIGILGGIGEWLAIGLAFGLAI
TASIYAVGAVSGAHINPAVTIALWATKEFDTKEVLPYILAQLIGATLGSILLIGCIGASA
ATIGGLGATAPSAGFTYMQAMLAEIVGTFLLMITIMGVAVDKKAPNKFAGLIIGLAVAGI
ITTIGGISGASLNPARTFGPYLMDMFYGIDLWVYFPIYVIGPILGALIGAFIYKYIREE
Download sequence
Identical sequences D7DSA3
gi|297618881|ref|YP_003706986.1| WP_013179741.1.83914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]