SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300782291|ref|YP_003762582.1| from Amycolatopsis mediterranei U32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300782291|ref|YP_003762582.1|
Domain Number 1 Region: 11-190
Classification Level Classification E-value
Superfamily Prim-pol domain 1.63e-18
Family Bifunctional DNA primase/polymerase N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300782291|ref|YP_003762582.1|
Sequence length 318
Comment hypothetical protein AMED_0358 [Amycolatopsis mediterranei U32]
Sequence
MTSSAQSAALRAAAMEMAGRGWKVFPCRPGSKAALWHRQEHCRGGGVCADGHVTPESLAT
SDVERVAARWSDGVAYNIAVYPGPSGLFILDCDIPKAARPGQPPARGEHDPDGWTQLQAL
AGQRGGPLPDTFTLATPSGGRQLWFTAPPGTLLRGTVKHVATNIDSRGWGTYGLAPGCVL
LNGAYELIDDTDPVELPGWLVQANVERASGAISGRPEKPVAAPDAYTARAVRAECDRVAS
EPPGRRNKVLSTAAYALGQLVGAEVLDREHARAELETAVAAWNTPASWAKDTGVIATSLA
AGEGNPRRINRRGPGRAA
Download sequence
Identical sequences A0A0H3CVV5 B2XSE2 G0FHG2
gi|300782291|ref|YP_003762582.1| gi|190404525|ref|YP_001965289.1|NC_010852 gi|399534178|ref|YP_006546840.1| gi|399534178|ref|YP_006546840.1| WP_012477112.1.53613 WP_012477112.1.63706 WP_012477112.1.79787 WP_012477112.1.88400 WP_012477112.1.99940 YP_003762582.1.66228 gi|532457040|ref|YP_008456692.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]