SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300785846|ref|YP_003766137.1| from Amycolatopsis mediterranei U32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300785846|ref|YP_003766137.1|
Domain Number 1 Region: 3-397
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.77e-79
Family Gtf glycosyltransferase 0.00000000655
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300785846|ref|YP_003766137.1|
Sequence length 398
Comment glycosyl transferase family protein [Amycolatopsis mediterranei U32]
Sequence
MTRVLLSTYGTRGDVDPLVALAVELRALGADVRMCTPPDEEFADRLAGLGIESVPVGPPV
RALMRPTAPPTAAELTRYRAELLETQFDVLPAAAGGCDALVAAGLAQVAARSVAEAAGIR
YVYATYAAVNLPSPHHAPPPRPGWPEPEGADNAALWELDAQRVNAQFREPLNAHRAALGL
QPVDNVRDHVYSERPWLAADPVLGPWPETAGLEVVQTGAWTRVDERPLPAELTAFLDDGP
PPVHVGFGSIGPAPDIARWSVEASRARGHRVLVSRGWADLAVDDCFAIGDVNHQRLFGRL
AAVVHHGGAGTTQTAARAGVPQVAVPLRVADNPYWAGRVAATGVGAALDGPTATFETLTA
AVDTALAPETRARAAALGAGIRTDGATTAARLLLDELR
Download sequence
Identical sequences A0A0H3D421 G0FVD7
gi|532460590|ref|YP_008460242.1| gi|399537729|ref|YP_006550391.1| gi|300785846|ref|YP_003766137.1| gi|399537729|ref|YP_006550391.1| WP_013225807.1.26188 WP_013225807.1.53613 WP_013225807.1.63706 WP_013225807.1.79787 WP_013225807.1.88400 WP_013225807.1.99940 YP_003766137.1.66228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]