SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300786493|ref|YP_003766784.1| from Amycolatopsis mediterranei U32

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|300786493|ref|YP_003766784.1|
Domain Number - Region: 129-201
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000183
Family PriA-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300786493|ref|YP_003766784.1|
Sequence length 314
Comment ATP-dependent DNA ligase [Amycolatopsis mediterranei U32]
Sequence
MADKAVELEVGHRTVRISNPDRVYFPARGETKLDLVNYYLSVGDGIVNALRERPCMLHRF
PSGVAGEKVHQKRVPNGAPPWLETVRVTFPRYNRHADELCVTELAHVAWAVQMSTVEFHP
WNSRRADTEKPDEWRIDLDPMPDCGFDRVRRVAHVAHEILDELGAVGWPKTSGGRGLHIY
VRIEPRWGFTDVRRAALAFAHEVERRAPDDVTTTWWRKDRDPRLLFVDYNQNARDHTIAS
AYSVRGNPEGTVSTPIRWTEIDDAEPGDFTIATVPARFAEVGDLHAGMDDAVFSLDPLLE
WADRDGVEEPPEPA
Download sequence
Identical sequences A0A0H3D7W5 G0FMN1
WP_013226451.1.26188 WP_013226451.1.53613 WP_013226451.1.63706 WP_013226451.1.79787 WP_013226451.1.88400 WP_013226451.1.99940 YP_003766784.1.66228 gi|300786493|ref|YP_003766784.1| gi|532461237|ref|YP_008460889.1| gi|399538376|ref|YP_006551038.1| gi|399538376|ref|YP_006551038.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]