SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300787269|ref|YP_003767560.1| from Amycolatopsis mediterranei U32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300787269|ref|YP_003767560.1|
Domain Number 1 Region: 1-384
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 6e-76
Family Gtf glycosyltransferase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300787269|ref|YP_003767560.1|
Sequence length 389
Comment glycosyl transferase family protein [Amycolatopsis mediterranei U32]
Sequence
MRVLITTWNWNTLYFPLVPLAWSLRAQGHEVVVATQPGLAGTVLRSGLPAAAVGESVDAG
AMMGGFLRRLADAEGVNPPHWRDMHRHGTQNCRLGVAACWTMMDGLLDFARRWRPDVVLY
EAWTYAGPMVADLLGVPAIRHTWGIDYAGLFREFEAEALAEVRAHWGLDEVPSLAAVSVD
PCPPQLQIASPGSRLLMQYVPYNGPGVLPDWLHEPSPRKRVCVSWGTSSGRFDRKMVVTG
QVVRAVAGLDVEVVAAVTAADADLIGELPANVRVVSGVPFNALLPRCDLVISHAGLGTVM
TALASGTPQLLVPQMTDTALNAELLAENGCGEFVLPSDATDEVLREKAARMLGDPAFSAA
TASVRDAMRQLPTPNEMAAHLTSLTSSMV
Download sequence
Identical sequences A0A0H3DAP6 G0FY65
gi|399539152|ref|YP_006551814.1| gi|300787269|ref|YP_003767560.1| gi|532462013|ref|YP_008461665.1| WP_013227218.1.26188 WP_013227218.1.53613 WP_013227218.1.63706 WP_013227218.1.79787 WP_013227218.1.88400 WP_013227218.1.99940 YP_003767560.1.66228 gi|399539152|ref|YP_006551814.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]