SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300787285|ref|YP_003767576.1| from Amycolatopsis mediterranei U32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300787285|ref|YP_003767576.1|
Domain Number 1 Region: 1-377
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 7.14e-74
Family Gtf glycosyltransferase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300787285|ref|YP_003767576.1|
Sequence length 377
Comment glycosyl transferase family protein [Amycolatopsis mediterranei U32]
Sequence
MRILFCTWAWPTHYQPMVTLGWAFRAAGHDVRVASQPSLVPVIRASGLPAVAVGRDEEIE
PAVARLLAADPRVRGSGKESRTVSAYAGIAEKMAGPLLALMRSWRPDLVVFEESTYAAAL
VATALGVPAVRHLWGVDILSYLRSFESAALATTASSLGLSTVDVAGAVTVDHCPPALQVP
GDFTRRHMRYVPFNGATVLPAWAAGPRTRPRICVTYGTTSSQLAFYECVIDRLVHAAAGL
PVEVVATVAGNDLAAVGPVPDNVRIVERIPLHTLLPSCDLLISQAGPSTALTAVSCGTPQ
LMIPQLPDQRLISTLVSAAGAGSKLDLAEADTETIRTAAAEILGDAAYREAAAGLARESR
EQPSPAEVVDGLVALAR
Download sequence
Identical sequences A0A0H3DC09 G0FY81
gi|532462029|ref|YP_008461681.1| gi|399539168|ref|YP_006551830.1| gi|300787285|ref|YP_003767576.1| gi|399539168|ref|YP_006551830.1| WP_013227234.1.26188 WP_013227234.1.53613 WP_013227234.1.63706 WP_013227234.1.79787 WP_013227234.1.88400 WP_013227234.1.99940 YP_003767576.1.66228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]