SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300788299|ref|YP_003768590.1| from Amycolatopsis mediterranei U32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300788299|ref|YP_003768590.1|
Domain Number 1 Region: 3-423
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.19e-72
Family Gtf glycosyltransferase 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300788299|ref|YP_003768590.1|
Sequence length 432
Comment glycosyl transferase family protein [Amycolatopsis mediterranei U32]
Sequence
MPSIMIATMPVHGHVTPLLAVARHFAGRGDRVRFLTGARFAELVAATGAEHLPLPAEADF
DDRQDWNRTFPERAALSGTRAIAHDLEHIFVRPGRAQHDAVMAAHAAEPADALLADPAFI
GGAFLLGHPLGVRPPIVMCGICPLMIASRDTAPFGTGLMPLRGPLGRLRNTALASLTAKV
LFPAIEQIADRTFHRVHGRSIPFAVLDWPRHADAIVQFTVPEFEYPRSDAPATLHFAGPI
SASGSRAPLPPWWPELDGSRPVVHLTQGTIGNSDYGQLIAPALDGLADEDVLIAVATGGR
PLDSLPPLPANARAAEFLPYDELLPKTDVYVTNGGYGGVQYALRYGVPIVAAGRQEDKPE
VIARVAWAGVGRRIRTRIPAPSTIRRAVRAVLDDHHYRDAACRIAGHIAGTRGVHELAEI
VDALVAERTASE
Download sequence
Identical sequences A0A0H3DDN4 G0FR35
gi|399540182|ref|YP_006552844.1| gi|399540182|ref|YP_006552844.1| gi|532463043|ref|YP_008462695.1| WP_013228237.1.26188 WP_013228237.1.53613 WP_013228237.1.63706 WP_013228237.1.79787 WP_013228237.1.88400 WP_013228237.1.99940 YP_003768590.1.66228 gi|300788299|ref|YP_003768590.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]