SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296108810|ref|YP_003615759.1| from methanocaldococcus infernus ME

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296108810|ref|YP_003615759.1|
Domain Number 1 Region: 312-358
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000785
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0065
Further Details:      
 
Weak hits

Sequence:  gi|296108810|ref|YP_003615759.1|
Domain Number - Region: 206-287
Classification Level Classification E-value
Superfamily Cyclophilin-like 0.0535
Family Cyclophilin (peptidylprolyl isomerase) 0.028
Further Details:      
 
Domain Number - Region: 366-483
Classification Level Classification E-value
Superfamily Cyclophilin-like 0.0629
Family TM1367-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296108810|ref|YP_003615759.1|
Sequence length 494
Comment methanogenesis marker protein 3 [methanocaldococcus infernus ME]
Sequence
MAEVIVNDKVKRGETLKDVLDGEFYKEGANIVIIKGIKKEAEATRKFLVKTNKGNITIAV
TEDNEASNFFLKNYKKFVKRVRWISHFDIAFGPTRIDLEVSDKEKVFNKWDVLLSLSGLD
KDEGHLVFITKKTSGIYGLEEPKIGRVVGGKWVLSNLGLKDYIIDIELISEEKELVDYIV
TTDLNTKLEDGWKIITYFEAEFFEVPSATEHCLAIMENHEFKIDEYTNTFIANASLKGLK
IEEGNLVDRDRGVITVRNFGDGEGKVFIYKESRSSSLSHTVVGKVRKGMELIDFSETGTL
TVKTVPERLCAIGLEVEKAIEMFEKHGIEVEVEGKGIVVEQEPEYTLNVLKEKKVKLKAI
SKENIITITLYDDKAPITSWYFRRTTGLTTKRVGKLHVYFKHKDIVMFKGNPDYAKGLLP
ENTPENVVKGLEIGVSNMVSRYKGMIGVRLSDHDKFGPTGESFEKTNIVGRVLENWEFLK
KVRTGEDIYILLKK
Download sequence
Identical sequences D5VQE2
gi|296108810|ref|YP_003615759.1| WP_013099541.1.24528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]