SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302335851|ref|YP_003801058.1| from Olsenella uli DSM 7084

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302335851|ref|YP_003801058.1|
Domain Number 1 Region: 1-211
Classification Level Classification E-value
Superfamily HAD-like 8.01e-41
Family beta-Phosphoglucomutase-like 0.057
Further Details:      
 
Domain Number 2 Region: 236-366
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 1.83e-22
Family Thiamin pyrophosphokinase, catalytic domain 0.0074
Further Details:      
 
Domain Number 3 Region: 396-453
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.0000458
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302335851|ref|YP_003801058.1|
Sequence length 459
Comment thiamine pyrophosphokinase [Olsenella uli DSM 7084]
Sequence
MPIKAAIFDCDGTLVDSMPLWHDVTVELLRRHHVADAEEAFVRTESLPMVEMCHAFHDEW
GVEAEGEELVRELVDMVREGYRSRVSLLPGCRAFLDELASAGVRMVVASSTAPEELSVAL
SAQGVDGYFERVFSTGGPIRSKDYPDIWELVLDYLGTDPADTWVFEDAPFGMRTARSVGA
NTVCLFSPHGDRDLAACERYADILVHSYHELSLALLDDYARPPQASPSAHPRLAPLRVLV
VGASPERPSSALLRSLAASTDYVIAADAGADALRSCGIAPDVFCGDADSATGESAAWARS
VARADIEFPSEKYATDLALAISCARHEAARRNARLELTLTGVTGGRPDHALAVVGQLARN
ADASPRIVEDGFECRLLSPSGTACWELGGAHVPAAGVEGTLFSAIPVAEGTMLSERGFKW
ELDHRELPLLGDEGISNVVTSATASVECHAGAVAAFLLA
Download sequence
Identical sequences E1QVM5
gi|302335851|ref|YP_003801058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]