SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302335090|ref|YP_003800297.1| from Olsenella uli DSM 7084

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302335090|ref|YP_003800297.1|
Domain Number 1 Region: 92-226
Classification Level Classification E-value
Superfamily Sortase 2.35e-42
Family Sortase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302335090|ref|YP_003800297.1|
Sequence length 282
Comment sortase family protein [Olsenella uli DSM 7084]
Sequence
MKRHLSTILLAFALLVGMGLLVYPSASDWWNSFHQSQAIAGYIRQVESNPDEENQAIWDA
AVAYNQGLDTSDGRFVLSSEEKEVYEGMLDVTGTGIMGYVSIPKISVSLPIYHGTDDTVL
QIAIGHIPGSSLPVGGEGTHTVISGHRGLPSARLFTDIDQLAEGDHFVLHVLGRTLTYEI
DQILTVPPDDLDALGIEGRQDLCTLVTCTPYGVNTHRLLVRGHRVPNDPEPSDGDVRTIG
CLPFVGAFAGAGLVILVTTGLARRKRGKPHDGPRHARRMGRR
Download sequence
Identical sequences E1QYF3
WP_013251169.1.19134 WP_013251169.1.33448 gi|302335090|ref|YP_003800297.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]