SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302390649|ref|YP_003826470.1| from Thermosediminibacter oceani DSM 16646

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302390649|ref|YP_003826470.1|
Domain Number 1 Region: 88-462,495-569
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.1e-164
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 8-87
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 9.68e-17
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302390649|ref|YP_003826470.1|
Sequence length 772
Comment ribonucleoside-diphosphate reductase [Thermosediminibacter oceani DSM 16646]
Sequence
MKNKKLRLTENARVVLQKRYLAKDEKGQVVETPEDMIERVARAVAAAEENYGQDPEFWAE
KFYDMMAELKFMPNSPTLMNAGRELGQLSACFVLPVEDSMEGIFGAIKNAALIHKSGGGT
GMSFSRLRPKGATVRSTGGEASGPVSFMKVFNAATEAVKQGGRRRGANMGILRVDHPDIL
EFIRCKEDNNELTNFNISVAITDKFMETLKNDGTYELVDPNTGKVTGRLKAREVFDLIVD
MAWKNGEPGILFIDRVNAKNPTPHIGQIESTNPCGEQPLLPFESCNLGSINLSKFVKEGS
TGNEIDYEELKQVVHMAVRFLDDVIDVNKYPLPEIEQMTKANRKIGLGVMGFADMLIKLG
IPYDSEEAVKLAEEVMGFIQREARKASEDLAKTRGAFPNFPGSVYDVPGGPLLRNATVTT
IAPTGTISIIAGCSSGIEPVFALAFERNVLDKQRLIEIYPLFEEEMRRRGLYSPELMEEV
LEKGSLKGIAGIPEEVKRVFVTAHDISPEWHVRIQAAFQKYTDNAVSKTVNFPHSATRED
VKKVYLLAYELGCKGVTVYRDGSREEQVLKKGTRQGQEAGAGTCGCEELPKEIKPRPRPS
VTYGSTEKVKIGCGNLYITVNSDEYGICEVFTNLGRAGGCPSQSEATSRLISLALRSGID
VKSIVEQLKGIRCHSTLRQMANNKDIKVLSCPDAIARAIERHIGARLAEGGNGVEFIKKI
YCAGDTATAADGNNPVREPGRGYKSYCPECNSVLEHESGCIVCRSCGYSKCG
Download sequence
Identical sequences D9S0I9
WP_013276855.1.79428 gi|302390649|ref|YP_003826470.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]