SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15004847|ref|NP_149307.1| from Clostridium acetobutylicum ATCC 824

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15004847|ref|NP_149307.1|
Domain Number 1 Region: 61-127
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.31e-16
Family Steroid-binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15004847|ref|NP_149307.1|
Sequence length 143
Comment steroid-binding protein [Clostridium acetobutylicum ATCC 824]
Sequence
MRFNVATKLYNHQMRINYYTLCMNTVVCPQIKKYYKNLIAAELKESRRLVIRSTFTNEYR
EPRREFTLEELSKYNGENGKPAYVAVNGTVYDLSLAPSWGGGTHFGLYAGKDLSSEFNSC
HKGIMSILTSLPRVGALIKEKII
Download sequence
Identical sequences Q97TF9
gi|337735174|ref|YP_004634622.1| NP_149307.1.94244 WP_010890828.1.17575 WP_010890828.1.17905 WP_010890828.1.48544 WP_010890828.1.57811 WP_010890828.1.71350 WP_010890828.1.92914 272562.CA_P0144 gi|15004847|ref|NP_149307.1| gi|384456684|ref|YP_005673021.1| gi|15004847|ref|NP_149307.1|NC_001988 gi|337735174|ref|YP_004634622.1|NC_015686 gi|384456684|ref|YP_005673021.1|NC_017296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]