SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15895147|ref|NP_348496.1| from Clostridium acetobutylicum ATCC 824

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15895147|ref|NP_348496.1|
Domain Number - Region: 7-77
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0183
Family BAR domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15895147|ref|NP_348496.1|
Sequence length 362
Comment replication initiation protein REP [Clostridium acetobutylicum ATCC 824]
Sequence
MDFENETLEKMEQKRIDYNRKYANWYKQMSKDMQQEKHLAYAETLKKKGERIKSCMNIWL
WDIYRKNKLLDLQKVNRCMNNRFCPNCRKFNLSCAIHNLKKPLNDLLLDGYYPYLVTLTI
PNVLGKELKRTIEKMNKAFKKLFGAYSYDLQGKTTKGFKDRLICFEGALKVLEITYNEES
NTYHPHFHCLFFSQQYDQELFIKNTPGEFSNKRNSYNFYSLLDIQIMKLWTMYFKEIRVN
EKNYNNTKLQDCFICDIREMDSAGIVEVLKYTFKDTDIKSYDVFKNIELAISNKRIRQGY
GILYNLKLEDDADGEKLSLEEFLNESEVPSLLVVREIKELLTSYRDYKKISRSKVHEDII
KI
Download sequence
Identical sequences Q97HY4
gi|15895147|ref|NP_348496.1| gi|384458597|ref|YP_005671017.1| gi|337737089|ref|YP_004636536.1| NP_348496.1.94244 WP_010965177.1.17575 WP_010965177.1.17905 WP_010965177.1.48544 WP_010965177.1.57811 WP_010965177.1.71350 WP_010965177.1.92914 272562.CA_C1872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]