SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15896522|ref|NP_349871.1| from Clostridium acetobutylicum ATCC 824

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15896522|ref|NP_349871.1|
Domain Number 1 Region: 214-732
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.8e-161
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.000000778
Further Details:      
 
Domain Number 2 Region: 18-213
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 2.09e-59
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000693
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15896522|ref|NP_349871.1|
Sequence length 743
Comment ribonucleotide-diphosphate reductase subunit alpha [Clostridium acetobutylicum ATCC 824]
Sequence
MVDVENLCKEALKGINDDENIYTKTKLINVLKHITREGMKEEEIIKSVIQVCLELTKADE
PKWLQGASRLYVINLYNEVRKNRNISENEDPYKGFYDFIVKLTDEGLYGKYILENYSKED
IYELESFIKKDRDFLFTYSGIKLLSERYLIQNFERKVLELPQQMFMGIAMHLAVPEKQEN
RVYWAKRFYDVLSSLKATMATPTMSNARKPFYQLSSCFIDTVDDSLKGIYKSLDNFANVS
KYGGGMGVYFGKVRSMGASIRGFKGASGGVVPWVKLFNDTAIAVDQLGVRNGSVAVWLDA
WHKDLPEFMQLRTNNGDDRKKAHDVFPGVCYPDLFWRLAEEDIDANWYMMCPHEIKLVKG
YSLEDYYGEEWEKRYFDCVNDPRIDKRMMSVKDIVRLIIKSAAETGTPFAFYRDAANRMN
PNKHKGMIYSSNLCTEIMQNMSAMDILEDEIIDENGDKIIVQKAKSGDFVVCNLSSIVLG
NVDVNDDEELQYVIETQIRAMDNVIDLNYYSVPFAEVTNKRYRGIGLGTSGYHHMLTNNR
VVWTSDDHFEFTDRVYEKINYYAIQASMNIAKDKGRYEYFEGSDWENGSYFKLRGYNSPK
WKALIAKIKKYGMRNGYIMAVAPNGSTATIAGTSEGVDPVMARFWMEEKKGSITPKIAPN
LSRENFWFYNSAYNIDQKLCVKINGIRQRHIDQSQSFNLYITTDYTMRQIMNLYIEAYKS
GVKSIYYVRSKSLTVGDCDSCSA
Download sequence
Identical sequences Q97E39
NP_349871.1.94244 WP_010966551.1.17575 WP_010966551.1.17905 WP_010966551.1.48544 WP_010966551.1.57811 WP_010966551.1.71350 WP_010966551.1.92914 gi|15896522|ref|NP_349871.1| 272562.CA_C3277 gi|337738481|ref|YP_004637928.1| gi|384459991|ref|YP_005672411.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]